General information for g8247.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Histone H4.
Parent gene
- The parent gene g8247 is located on chr_2: 29274281..29274592 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8247 | g8247.t1 | TTS | g8247.t1 | 23583552 | 23583552 |
| chr_2 | g8247 | g8247.t1 | isoform | g8247.t1 | 29274281 | 29274592 |
| chr_2 | g8247 | g8247.t1 | exon | g8247.t1.exon1 | 29274281 | 29274592 |
| chr_2 | g8247 | g8247.t1 | cds | g8247.t1.CDS1 | 29274281 | 29274592 |
| chr_2 | g8247 | g8247.t1 | TSS | g8247.t1 | NA | NA |
Sequences
>g8247.t1 Gene=g8247 Length=312
ATGACAGGCCGTGGCAAAGGAGGCAAAGGTTTAGGAAAAGGAGGTGCAAAGCGTCATCGC
AAAGTTCTTCGTGATAACATCCAAGGTATCACAAAACCAGCCATTCGTCGTTTGGCTCGT
CGTGGTGGTGTCAAGCGTATCTCAGGCTTGATCTACGAAGAAACTCGTGGTGTCTTGAAA
GTTTTCTTGGAAAATGTCATTCGTGATGCAGTCACATACACTGAACACGCTAAACGCAAG
ACAGTTACAGCTATGGATGTCGTCTATGCCTTGAAACGTCAAGGACGCACTCTCTATGGT
TTCGGAGGATAA
>g8247.t1 Gene=g8247 Length=103
MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 12 | g8247.t1 | CDD | cd00076 | H4 | 18 | 101 | 1.49589E-43 |
| 11 | g8247.t1 | Gene3D | G3DSA:1.10.20.10 | Histone | 2 | 103 | 2.2E-60 |
| 16 | g8247.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 20 | - |
| 2 | g8247.t1 | PANTHER | PTHR10484 | HISTONE H4 | 1 | 103 | 1.1E-68 |
| 3 | g8247.t1 | PANTHER | PTHR10484:SF185 | HISTONE H4 | 1 | 103 | 1.1E-68 |
| 4 | g8247.t1 | PRINTS | PR00623 | Histone H4 signature | 5 | 16 | 1.4E-63 |
| 7 | g8247.t1 | PRINTS | PR00623 | Histone H4 signature | 20 | 39 | 1.4E-63 |
| 5 | g8247.t1 | PRINTS | PR00623 | Histone H4 signature | 40 | 60 | 1.4E-63 |
| 9 | g8247.t1 | PRINTS | PR00623 | Histone H4 signature | 62 | 76 | 1.4E-63 |
| 6 | g8247.t1 | PRINTS | PR00623 | Histone H4 signature | 77 | 89 | 1.4E-63 |
| 8 | g8247.t1 | PRINTS | PR00623 | Histone H4 signature | 89 | 100 | 1.4E-63 |
| 1 | g8247.t1 | Pfam | PF15511 | Centromere kinetochore component CENP-T histone fold | 35 | 96 | 2.2E-8 |
| 13 | g8247.t1 | ProSitePatterns | PS00047 | Histone H4 signature. | 15 | 19 | - |
| 15 | g8247.t1 | SMART | SM00417 | h44 | 16 | 90 | 2.9E-29 |
| 14 | g8247.t1 | SMART | SM00803 | TAF_cls | 28 | 93 | 0.0086 |
| 10 | g8247.t1 | SUPERFAMILY | SSF47113 | Histone-fold | 3 | 102 | 8.38E-33 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003677 | DNA binding | MF |
| GO:0046982 | protein heterodimerization activity | MF |
| GO:0006352 | DNA-templated transcription, initiation | BP |
| GO:0000786 | nucleosome | CC |
KEGG
Orthology
- This transcript has been annotated with K11254 (histone H4)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
