General information for g8325.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g8325 is located on chr_2: 29780576..29780913 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8325 | g8325.t1 | TTS | g8325.t1 | 29780285 | 29780285 |
| chr_2 | g8325 | g8325.t1 | isoform | g8325.t1 | 29780576 | 29780913 |
| chr_2 | g8325 | g8325.t1 | exon | g8325.t1.exon1 | 29780576 | 29780698 |
| chr_2 | g8325 | g8325.t1 | cds | g8325.t1.CDS1 | 29780576 | 29780698 |
| chr_2 | g8325 | g8325.t1 | exon | g8325.t1.exon2 | 29780767 | 29780913 |
| chr_2 | g8325 | g8325.t1 | cds | g8325.t1.CDS2 | 29780767 | 29780913 |
| chr_2 | g8325 | g8325.t1 | TSS | g8325.t1 | 29781046 | 29781046 |
Sequences
>g8325.t1 Gene=g8325 Length=270
ATGGCAAAAGGAAAGGGAGCTACTAAAGCATCAAAGAAAATTGCAAAAGCAAAAAAAGCA
TTGGATACAAGCGTGGCTGGCGGTGAATCAGTAAAGAAAGTTAAACGAGCTCGTCGCAAG
GAATCTTATTCGATCTACATTTTCAAGGTTTTGAAACAAGTCCATCCTGACACTGGCATT
TCGTCAAAAGCTATGAGTATTATGAACTCTTTCGTTAATGATGTCTTTGAACGTATTGCA
GCTGAAGCTTCTCGTTTATCTCAATTATAA
>g8325.t1 Gene=g8325 Length=89
MAKGKGATKASKKIAKAKKALDTSVAGGESVKKVKRARRKESYSIYIFKVLKQVHPDTGI
SSKAMSIMNSFVNDVFERIAAEASRLSQL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g8325.t1 | Gene3D | G3DSA:1.10.20.10 | Histone | 2 | 89 | 0 |
| 2 | g8325.t1 | PANTHER | PTHR23428:SF288 | HISTONE H2B TYPE 2-C-RELATED | 10 | 87 | 0 |
| 3 | g8325.t1 | PANTHER | PTHR23428 | HISTONE H2B | 10 | 87 | 0 |
| 4 | g8325.t1 | PRINTS | PR00621 | Histone H2B signature | 43 | 61 | 0 |
| 5 | g8325.t1 | PRINTS | PR00621 | Histone H2B signature | 62 | 82 | 0 |
| 1 | g8325.t1 | Pfam | PF00125 | Core histone H2A/H2B/H3/H4 | 8 | 87 | 0 |
| 7 | g8325.t1 | SMART | SM00427 | h2b3 | 32 | 89 | 0 |
| 6 | g8325.t1 | SUPERFAMILY | SSF47113 | Histone-fold | 19 | 88 | 0 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003677 | DNA binding | MF |
| GO:0046982 | protein heterodimerization activity | MF |
| GO:0000786 | nucleosome | CC |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed