Chromosome | Gene | Transcript | Category | ID | Start | End |
---|---|---|---|---|---|---|
chr_2 | g8749 | g8749.t3 | TTS | g8749.t3 | 32790268 | 32790268 |
chr_2 | g8749 | g8749.t3 | isoform | g8749.t3 | 32790384 | 32791039 |
chr_2 | g8749 | g8749.t3 | exon | g8749.t3.exon1 | 32790384 | 32790538 |
chr_2 | g8749 | g8749.t3 | cds | g8749.t3.CDS1 | 32790384 | 32790538 |
chr_2 | g8749 | g8749.t3 | exon | g8749.t3.exon2 | 32790599 | 32790928 |
chr_2 | g8749 | g8749.t3 | cds | g8749.t3.CDS2 | 32790599 | 32790887 |
chr_2 | g8749 | g8749.t3 | exon | g8749.t3.exon3 | 32791015 | 32791039 |
chr_2 | g8749 | g8749.t3 | TSS | g8749.t3 | 32791642 | 32791642 |
>g8749.t3 Gene=g8749 Length=510
ACTGATATTGCAAAATATACAATTGGTCGATTACGTCCTCATTTCTTAAGTGTTTGCCAA
CCGATTATGCCTGATGGAACTAATTGCTCGGATATAATAAATCACAACAAATACATCATT
GATTTCACATGCAGTAATGAAAATGCTTCAAAAAGGAAGTTAAAAGAAATGAGATTGAGT
TTTCTAAGTGGACATAGTTCATTTAGTATGTACACGATGGTCTATGCTGCTCTTTATATT
CATAGCCGCATGGAATGGAAAGGATCAAAGTTATTTAAACATTTTCTTCAATTTATATTT
ATTGCATTGGCATGGTATACAGCATTATCAAGAGTCAGCAATTATAAGCATCACTGGTCC
GATGTGATGGCGGGTTCCATTCAAGGTCTATTTGTTTCATTGTTAATCGTCTTCGGTGTT
TCTGGTCTATTCAAAAATAAATTCAAAATTGTTGAACAACCAAAAGGATCACGTTATGAG
TTAAACTCGCATAGTACCAGAAGCAATTAG
>g8749.t3 Gene=g8749 Length=147
MPDGTNCSDIINHNKYIIDFTCSNENASKRKLKEMRLSFLSGHSSFSMYTMVYAALYIHS
RMEWKGSKLFKHFLQFIFIALAWYTALSRVSNYKHHWSDVMAGSIQGLFVSLLIVFGVSG
LFKNKFKIVEQPKGSRYELNSHSTRSN
Transcript | Database | ID | Name | Start | End | E.value | |
---|---|---|---|---|---|---|---|
13 | g8749.t3 | CDD | cd03384 | PAP2_wunen | 1 | 115 | 3.53933E-46 |
5 | g8749.t3 | Gene3D | G3DSA:1.20.144.10 | - | 3 | 145 | 4.7E-23 |
2 | g8749.t3 | PANTHER | PTHR10165 | LIPID PHOSPHATE PHOSPHATASE | 2 | 125 | 4.1E-45 |
3 | g8749.t3 | PANTHER | PTHR10165:SF173 | FI04477P-RELATED | 2 | 125 | 4.1E-45 |
1 | g8749.t3 | Pfam | PF01569 | PAP2 superfamily | 26 | 116 | 7.4E-19 |
9 | g8749.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 36 | - |
12 | g8749.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 37 | 57 | - |
6 | g8749.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 58 | 68 | - |
11 | g8749.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 69 | 88 | - |
8 | g8749.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 89 | 99 | - |
10 | g8749.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 100 | 122 | - |
7 | g8749.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 123 | 147 | - |
17 | g8749.t3 | SMART | SM00014 | acid_phosph_2 | 8 | 115 | 2.9E-14 |
4 | g8749.t3 | SUPERFAMILY | SSF48317 | Acid phosphatase/Vanadium-dependent haloperoxidase | 34 | 115 | 2.75E-16 |
15 | g8749.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 37 | 59 | - |
16 | g8749.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 74 | 93 | - |
14 | g8749.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 100 | 122 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
GOID | TERM | ONTOLOGY |
---|---|---|
GO:0042577 | lipid phosphatase activity | MF |
GO:0006644 | phospholipid metabolic process | BP |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.