General information for g877.t22
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g877 is located on chr_3: 6619998..6629641 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g877 | g877.t22 | TSS | g877.t22 | 6618107 | 6618107 |
| chr_3 | g877 | g877.t22 | isoform | g877.t22 | 6618133 | 6628188 |
| chr_3 | g877 | g877.t22 | exon | g877.t22.exon1 | 6618133 | 6618367 |
| chr_3 | g877 | g877.t22 | cds | g877.t22.CDS1 | 6618133 | 6618367 |
| chr_3 | g877 | g877.t22 | exon | g877.t22.exon2 | 6618433 | 6618560 |
| chr_3 | g877 | g877.t22 | cds | g877.t22.CDS2 | 6618433 | 6618560 |
| chr_3 | g877 | g877.t22 | exon | g877.t22.exon3 | 6618658 | 6618718 |
| chr_3 | g877 | g877.t22 | cds | g877.t22.CDS3 | 6618658 | 6618711 |
| chr_3 | g877 | g877.t22 | exon | g877.t22.exon4 | 6619039 | 6619144 |
| chr_3 | g877 | g877.t22 | exon | g877.t22.exon5 | 6628078 | 6628188 |
| chr_3 | g877 | g877.t22 | TTS | g877.t22 | NA | NA |
Sequences
>g877.t22 Gene=g877 Length=641
ATGAAGCTCTCTTTAGCATTAATTGTTGTTTTTATCAATGGAATATTTGGTTTTAAAGTG
TTGGGAATTTTGCCTTTTGGCAGCAAGTCACATTTTGCAATTGGACATGCAATTTTGAAA
AGTTTAGCAGAAGCTGGACATAATGTAACGTCGATTTCACCATATCCATTAAAAGAACCT
ATGGAAAATTACAAAGATATCAGCACAGAAGATTACGTTGAAGTATTTTTTAAAAATAAT
GCTGTGAATATGTTTGCTTTTGAAAATACTCCTATCGTCAATAAAATTATGGAATTAATA
TTTATTTATTGGATTAATCGAAATGGCAATGAAGTTGTGAAATATCATGCAGTTCATCCT
AAAGCAAAGTTATTTCGTATACCACAACAGCTGTTGTTAAATGGGCTGATGATATGACTG
GAAACGTTTCACCACCATCATATGTACCAAGACCGTATGTTCAATATTCAGATAAAATGT
CATTCAGAGAACGACTTATGAATACATTTTACGCTCACATTGAAGACATATTTATGAGTT
CATCATAAAAACCAAACCAAAGAAGACTTATGCAGAAATATTTCCCAATGCAACTAAAAC
ATTTGGAACGAGATGTACAAAGATATCTCAATGATTTTCAT
>g877.t22 Gene=g877 Length=138
MKLSLALIVVFINGIFGFKVLGILPFGSKSHFAIGHAILKSLAEAGHNVTSISPYPLKEP
MENYKDISTEDYVEVFFKNNAVNMFAFENTPIVNKIMELIFIYWINRNGNEVVKYHAVHP
KAKLFRIPQQLLLNGLMI
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g877.t22 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 17 | - |
| 5 | g877.t22 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 2 | - |
| 6 | g877.t22 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 3 | 12 | - |
| 7 | g877.t22 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 13 | 17 | - |
| 3 | g877.t22 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 18 | 138 | - |
| 2 | g877.t22 | SUPERFAMILY | SSF53756 | UDP-Glycosyltransferase/glycogen phosphorylase | 18 | 84 | 2.78E-7 |
| 1 | g877.t22 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 5 | 27 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed