General information for g8911.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Translocator protein.
Parent gene
- The parent gene g8911 is located on chr_2: 33783792..33784679 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8911 | g8911.t1 | TTS | g8911.t1 | 33783679 | 33783679 |
| chr_2 | g8911 | g8911.t1 | isoform | g8911.t1 | 33783792 | 33784385 |
| chr_2 | g8911 | g8911.t1 | exon | g8911.t1.exon1 | 33783792 | 33783992 |
| chr_2 | g8911 | g8911.t1 | cds | g8911.t1.CDS1 | 33783792 | 33783992 |
| chr_2 | g8911 | g8911.t1 | exon | g8911.t1.exon2 | 33784047 | 33784385 |
| chr_2 | g8911 | g8911.t1 | cds | g8911.t1.CDS2 | 33784047 | 33784385 |
| chr_2 | g8911 | g8911.t1 | TSS | g8911.t1 | 33784457 | 33784457 |
Sequences
>g8911.t1 Gene=g8911 Length=540
ATGCCAATTTCATCTTGCTTTGAAAAACCAGCTGTACAAATAGCTACTGCTATTTTAATT
CCAAATCTTGGCGGATGGATATCCGGAATTCAAACAAAAAAGCAAATTAAGGGCTGGTAT
GAGACTCTTGTGCTTCCAAAATGCCGTCCACCAAATTGGGTATTTCCAATAGCTTGGACT
TCTCTATATACTACAATGGGTTATGCGAGTTATATCGTTTGGAAGCAAGGACATGGTTTT
GATGGACCGGCTCATTTTCCTCTGATTTTGTATGGAGCTCAGCTTGCTTTGAACTTTGCA
TGGACACCAATCTTTTTTGTAAAGCATGAACTTAAATGGAGTTTTGTTGAAATTATTGCT
TTAACGGCTACTGCTGCTGCTACTGGAATATCATTCTACAAAATTGATAAAACTGCCGGA
CTTTTATTTGTCCCATACCTTGCTTGGCTCAGTTTTGCGAGTTATTTGAACCATTCGATA
TGGAAAAACAACACACCGGCAATCGAAGACAAGAAACCGGAAGCGGTAAAGGAAAAATAA
>g8911.t1 Gene=g8911 Length=179
MPISSCFEKPAVQIATAILIPNLGGWISGIQTKKQIKGWYETLVLPKCRPPNWVFPIAWT
SLYTTMGYASYIVWKQGHGFDGPAHFPLILYGAQLALNFAWTPIFFVKHELKWSFVEIIA
LTATAAATGISFYKIDKTAGLLFVPYLAWLSFASYLNHSIWKNNTPAIEDKKPEAVKEK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 21 | g8911.t1 | CDD | cd15904 | TSPO_MBR | 18 | 161 | 4.16201E-51 |
| 8 | g8911.t1 | Gene3D | G3DSA:1.20.1260.100 | - | 8 | 165 | 5.8E-61 |
| 2 | g8911.t1 | PANTHER | PTHR10057 | PERIPHERAL-TYPE BENZODIAZEPINE RECEPTOR | 11 | 170 | 1.2E-57 |
| 20 | g8911.t1 | PIRSF | PIRSF005859 | PBR | 7 | 165 | 3.9E-51 |
| 1 | g8911.t1 | Pfam | PF03073 | TspO/MBR family | 17 | 161 | 1.4E-49 |
| 12 | g8911.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 11 | - |
| 19 | g8911.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 32 | - |
| 10 | g8911.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 33 | 52 | - |
| 15 | g8911.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 53 | 74 | - |
| 14 | g8911.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 75 | 85 | - |
| 17 | g8911.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 86 | 107 | - |
| 9 | g8911.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 108 | 113 | - |
| 16 | g8911.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 114 | 133 | - |
| 13 | g8911.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 134 | 138 | - |
| 18 | g8911.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 139 | 156 | - |
| 11 | g8911.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 157 | 179 | - |
| 7 | g8911.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 10 | 32 | - |
| 3 | g8911.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 52 | 74 | - |
| 5 | g8911.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 84 | 106 | - |
| 4 | g8911.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 113 | 135 | - |
| 6 | g8911.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 139 | 161 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
- This transcript has been annotated with K05770 (translocator protein)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
