General information for g9154.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Ubiquitin-conjugating enzyme E2 G1.
Parent gene
- The parent gene g9154 is located on chr_1: 524086..525043 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9154 | g9154.t1 | TTS | g9154.t1 | 523468 | 523468 |
| chr_1 | g9154 | g9154.t1 | isoform | g9154.t1 | 524086 | 525043 |
| chr_1 | g9154 | g9154.t1 | exon | g9154.t1.exon1 | 524086 | 524321 |
| chr_1 | g9154 | g9154.t1 | cds | g9154.t1.CDS1 | 524086 | 524321 |
| chr_1 | g9154 | g9154.t1 | exon | g9154.t1.exon2 | 524382 | 524477 |
| chr_1 | g9154 | g9154.t1 | cds | g9154.t1.CDS2 | 524382 | 524477 |
| chr_1 | g9154 | g9154.t1 | exon | g9154.t1.exon3 | 524544 | 524573 |
| chr_1 | g9154 | g9154.t1 | cds | g9154.t1.CDS3 | 524544 | 524573 |
| chr_1 | g9154 | g9154.t1 | exon | g9154.t1.exon4 | 524758 | 524826 |
| chr_1 | g9154 | g9154.t1 | cds | g9154.t1.CDS4 | 524758 | 524826 |
| chr_1 | g9154 | g9154.t1 | exon | g9154.t1.exon5 | 525028 | 525043 |
| chr_1 | g9154 | g9154.t1 | cds | g9154.t1.CDS5 | 525028 | 525043 |
| chr_1 | g9154 | g9154.t1 | TSS | g9154.t1 | NA | NA |
Sequences
>g9154.t1 Gene=g9154 Length=447
ATGATGTGTAAAACTTGTTTCTCGGCAGGACTTGTTGATGACAATGATATTTTCAAATGG
GAAGTGCTGATAATTGGTCCTCCAGATACTTTATATGAAGGCGGATTCTTTAAAGCTCAT
CTTTACTTCCCTAAAGAATATCCACTAAGACCTCCTCGCATGCGTTTTGTTACAGAAATT
TGGCATCCAAATATTGATCAAAATGGAGATGTCTGCATTAGTATCTTGCATGAACCTGGT
GATGACAAATGGGGATATGAAAAAGCTTCAGAACGTTGGCTTCCGGTACACACAGTTGAG
ACAATTATTATTTCAGTTATTTCAATGTTAGCCGAACCGAATGATGAGTCACCTGCTAAT
GTAGATGCAGCAAAGCAATGGCGAGAAGCTTATCCGGAATTTAAGCGAAGAGTAGCTCGT
TGTGTCCGTAAAAGTCAAGAGGAGTAA
>g9154.t1 Gene=g9154 Length=148
MMCKTCFSAGLVDDNDIFKWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPPRMRFVTEI
WHPNIDQNGDVCISILHEPGDDKWGYEKASERWLPVHTVETIIISVISMLAEPNDESPAN
VDAAKQWREAYPEFKRRVARCVRKSQEE
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g9154.t1 | CDD | cd00195 | UBCc | 7 | 142 | 3.41214E-59 |
| 5 | g9154.t1 | Gene3D | G3DSA:3.10.110.10 | Ubiquitin Conjugating Enzyme | 3 | 148 | 5.8E-66 |
| 2 | g9154.t1 | PANTHER | PTHR24067:SF258 | UBIQUITIN-CONJUGATING ENZYME E2G 1A (UBC7 HOMOLOG, YEAST) | 6 | 147 | 1.8E-78 |
| 3 | g9154.t1 | PANTHER | PTHR24067 | UBIQUITIN-CONJUGATING ENZYME E2 | 6 | 147 | 1.8E-78 |
| 1 | g9154.t1 | Pfam | PF00179 | Ubiquitin-conjugating enzyme | 5 | 141 | 3.0E-48 |
| 7 | g9154.t1 | ProSitePatterns | PS00183 | Ubiquitin-conjugating enzymes active site. | 61 | 76 | - |
| 9 | g9154.t1 | ProSiteProfiles | PS50127 | Ubiquitin-conjugating enzymes family profile. | 7 | 136 | 38.182 |
| 8 | g9154.t1 | SMART | SM00212 | ubc_7 | 4 | 147 | 3.1E-56 |
| 4 | g9154.t1 | SUPERFAMILY | SSF54495 | UBC-like | 6 | 145 | 2.82E-53 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K10575 (ubiquitin-conjugating enzyme E2 G1)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
