General information for g9156.t12
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Ubiquitin-conjugating enzyme E2 G1.
Parent gene
- The parent gene g9156 is located on chr_1: 528625..530131 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9156 | g9156.t12 | TTS | g9156.t12 | 528549 | 528549 |
| chr_1 | g9156 | g9156.t12 | isoform | g9156.t12 | 528625 | 529740 |
| chr_1 | g9156 | g9156.t12 | exon | g9156.t12.exon1 | 528625 | 528860 |
| chr_1 | g9156 | g9156.t12 | cds | g9156.t12.CDS1 | 528625 | 528860 |
| chr_1 | g9156 | g9156.t12 | exon | g9156.t12.exon2 | 528921 | 529039 |
| chr_1 | g9156 | g9156.t12 | cds | g9156.t12.CDS2 | 528921 | 529039 |
| chr_1 | g9156 | g9156.t12 | exon | g9156.t12.exon3 | 529293 | 529365 |
| chr_1 | g9156 | g9156.t12 | cds | g9156.t12.CDS3 | 529293 | 529365 |
| chr_1 | g9156 | g9156.t12 | exon | g9156.t12.exon4 | 529499 | 529652 |
| chr_1 | g9156 | g9156.t12 | cds | g9156.t12.CDS4 | 529499 | 529565 |
| chr_1 | g9156 | g9156.t12 | exon | g9156.t12.exon5 | 529733 | 529740 |
| chr_1 | g9156 | g9156.t12 | TSS | g9156.t12 | 529971 | 529971 |
Sequences
>g9156.t12 Gene=g9156 Length=590
AGAAAGAGATACACTTCTGCCTTTTAGCAGTACTATAAATTAGCACCAAATTGCTCGAGA
GTACATTTTGGAAAGACTAAATTAAATTCTTTTTGATGGACACAACTGCATCACTTCTTT
TAAAAAAGCAATTAGCAGAGCTCAATAAGCACCCAGTAGAAGGTTTCTCGGCAGGACTTG
TTGATGACAATGATATTTTCAAATGGGAAGTGCTGATAATTGGTCCTCCAGGTTTTATTG
ATTGTCATCTTATTACAGCTCATCTTTACTTCCCTAAAGAATATCCACTAAGACCTCCTC
GCATGCGTTTTGTTACAGAAATTTGGCATCCAAATATTGATCAAAATGGAGATGTCTGCA
TTAGTATCTTGCATGAACCTGGTGATGACAAATGGGGATATGAAAAAGCTTCAGAACGTT
GGCTTCCGGTACACACAGTTGAGACAATTATTATTTCAGTTATTTCAATGTTAGCCGAAC
CGAATGATGAGTCACCTGCTAATGTAGATGCAGCAAAGCAATGGCGAGAAGCTTATCCGG
AATTTAAGCGAAGAGTAGCTCGTTGTGTCCGTAAAAGTCAAGAGGAGTAA
>g9156.t12 Gene=g9156 Length=164
MDTTASLLLKKQLAELNKHPVEGFSAGLVDDNDIFKWEVLIIGPPGFIDCHLITAHLYFP
KEYPLRPPRMRFVTEIWHPNIDQNGDVCISILHEPGDDKWGYEKASERWLPVHTVETIII
SVISMLAEPNDESPANVDAAKQWREAYPEFKRRVARCVRKSQEE
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g9156.t12 | CDD | cd00195 | UBCc | 8 | 158 | 1.611E-54 |
| 5 | g9156.t12 | Gene3D | G3DSA:3.10.110.10 | Ubiquitin Conjugating Enzyme | 3 | 164 | 1.0E-61 |
| 2 | g9156.t12 | PANTHER | PTHR24067:SF258 | UBIQUITIN-CONJUGATING ENZYME E2G 1A (UBC7 HOMOLOG, YEAST) | 7 | 163 | 4.1E-77 |
| 3 | g9156.t12 | PANTHER | PTHR24067 | UBIQUITIN-CONJUGATING ENZYME E2 | 7 | 163 | 4.1E-77 |
| 1 | g9156.t12 | Pfam | PF00179 | Ubiquitin-conjugating enzyme | 9 | 157 | 7.2E-43 |
| 7 | g9156.t12 | ProSitePatterns | PS00183 | Ubiquitin-conjugating enzymes active site. | 77 | 92 | - |
| 9 | g9156.t12 | ProSiteProfiles | PS50127 | Ubiquitin-conjugating enzymes family profile. | 7 | 152 | 35.124 |
| 8 | g9156.t12 | SMART | SM00212 | ubc_7 | 7 | 163 | 1.6E-54 |
| 4 | g9156.t12 | SUPERFAMILY | SSF54495 | UBC-like | 4 | 161 | 7.77E-50 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K10575 (ubiquitin-conjugating enzyme E2 G1)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
