Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative 40S ribosomal protein S10b.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g9278 g9278.t18 TSS g9278.t18 1399145 1399145
chr_1 g9278 g9278.t18 isoform g9278.t18 1399146 1399725
chr_1 g9278 g9278.t18 exon g9278.t18.exon1 1399146 1399288
chr_1 g9278 g9278.t18 cds g9278.t18.CDS1 1399146 1399288
chr_1 g9278 g9278.t18 exon g9278.t18.exon2 1399400 1399631
chr_1 g9278 g9278.t18 cds g9278.t18.CDS2 1399400 1399631
chr_1 g9278 g9278.t18 exon g9278.t18.exon3 1399687 1399725
chr_1 g9278 g9278.t18 cds g9278.t18.CDS3 1399687 1399725
chr_1 g9278 g9278.t18 TTS g9278.t18 1399800 1399800

Sequences

>g9278.t18 Gene=g9278 Length=414
ATGTTTATGCCAAAAGCACATAAAGTGGCGATCTATGAACATCTCTTCAAAGAAGGAGTT
CTTGTTGCACAAAAGGATTTTCATGCACCAAAACATCCCGAACTCGAGAGCGTTCCAAAT
CTTCATGTAATTAAGACTATGCAGTATCTCACAAATGAAGGCATTGAATATTTGCGTCAA
TATCTTCATTTGCCACCAGAAATCGTTCCATCAACATTGAAGCGAACAACTCGCTCAGAT
GCTGCTCGTCCTCGCGCTGCTCCACGTTCAGATGGACCAAAATCAGGAGAAGATCGTCAA
GCATACAGACGTGCACCAGGGCAATCGTCAGACAAAAAAGCCGATGTTGGTGCTGGTGCA
GCTGATATTGAATTGCGTGGTGGATTCGGTCGTGGCTCAAGAGGCCCACAGTAA

>g9278.t18 Gene=g9278 Length=137
MFMPKAHKVAIYEHLFKEGVLVAQKDFHAPKHPELESVPNLHVIKTMQYLTNEGIEYLRQ
YLHLPPEIVPSTLKRTTRSDAARPRAAPRSDGPKSGEDRQAYRRAPGQSSDKKADVGAGA
ADIELRGGFGRGSRGPQ

Protein features from InterProScan

Transcript Database ID Name Start End E.value
7 g9278.t18 Gene3D G3DSA:1.10.10.10 winged helix repressor DNA binding domain 1 49 8.3E-17
6 g9278.t18 Gene3D G3DSA:1.10.10.10 winged helix repressor DNA binding domain 50 88 1.2E-10
5 g9278.t18 MobiDBLite mobidb-lite consensus disorder prediction 68 137 -
4 g9278.t18 MobiDBLite mobidb-lite consensus disorder prediction 78 110 -
3 g9278.t18 PANTHER PTHR12146 40S RIBOSOMAL PROTEIN S10 1 49 8.7E-37
2 g9278.t18 PANTHER PTHR12146 40S RIBOSOMAL PROTEIN S10 49 133 8.7E-37
1 g9278.t18 Pfam PF03501 Plectin/S10 domain 3 49 8.6E-15

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed