General information for g9553.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Acylphosphatase-2.
Parent gene
- The parent gene g9553 is located on chr_1: 4039212..4039698 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9553 | g9553.t1 | TTS | g9553.t1 | 4038960 | 4038960 |
| chr_1 | g9553 | g9553.t1 | isoform | g9553.t1 | 4039212 | 4039698 |
| chr_1 | g9553 | g9553.t1 | exon | g9553.t1.exon1 | 4039212 | 4039338 |
| chr_1 | g9553 | g9553.t1 | cds | g9553.t1.CDS1 | 4039212 | 4039338 |
| chr_1 | g9553 | g9553.t1 | exon | g9553.t1.exon2 | 4039399 | 4039508 |
| chr_1 | g9553 | g9553.t1 | cds | g9553.t1.CDS2 | 4039399 | 4039508 |
| chr_1 | g9553 | g9553.t1 | exon | g9553.t1.exon3 | 4039569 | 4039585 |
| chr_1 | g9553 | g9553.t1 | cds | g9553.t1.CDS3 | 4039569 | 4039585 |
| chr_1 | g9553 | g9553.t1 | exon | g9553.t1.exon4 | 4039644 | 4039698 |
| chr_1 | g9553 | g9553.t1 | cds | g9553.t1.CDS4 | 4039644 | 4039698 |
| chr_1 | g9553 | g9553.t1 | TSS | g9553.t1 | 4039778 | 4039778 |
Sequences
>g9553.t1 Gene=g9553 Length=309
ATGGCTGCTTCAAAAATTATTGCTTTAGACTTTGAAGTATTCGGTACTGTACAAGGTGTA
TTTTTTAGAAAGTTTACGGAAGAGACTGCAAATAAATTTAACGTTAGAGGATGGTGCATG
AATACAAGAGATGGAACAGTCAAAGGCCAAATTGAAGGCGAGGAACCAAAAATCAATTTA
ATGAAGGAATGGCTCTCAAAGACAGGATCGCCTCAATCAACAATTGAGAAAACAGTATTT
TCTGAACCTAAACATTTGACCGATTATACATTTGACAAATTCGAAATAAGAAGATTCTCA
AAGAAATAA
>g9553.t1 Gene=g9553 Length=102
MAASKIIALDFEVFGTVQGVFFRKFTEETANKFNVRGWCMNTRDGTVKGQIEGEEPKINL
MKEWLSKTGSPQSTIEKTVFSEPKHLTDYTFDKFEIRRFSKK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g9553.t1 | Gene3D | G3DSA:3.30.70.100 | - | 1 | 98 | 1.6E-37 |
| 2 | g9553.t1 | PANTHER | PTHR10029 | ACYLPHOSPHATASE | 3 | 98 | 1.0E-34 |
| 4 | g9553.t1 | PRINTS | PR00112 | Acylphosphatase signature | 8 | 23 | 2.8E-20 |
| 5 | g9553.t1 | PRINTS | PR00112 | Acylphosphatase signature | 29 | 54 | 2.8E-20 |
| 3 | g9553.t1 | PRINTS | PR00112 | Acylphosphatase signature | 64 | 84 | 2.8E-20 |
| 1 | g9553.t1 | Pfam | PF00708 | Acylphosphatase | 10 | 96 | 8.9E-23 |
| 8 | g9553.t1 | ProSitePatterns | PS00150 | Acylphosphatase signature 1. | 13 | 23 | - |
| 7 | g9553.t1 | ProSitePatterns | PS00151 | Acylphosphatase signature 2. | 37 | 53 | - |
| 10 | g9553.t1 | ProSiteProfiles | PS51160 | Acylphosphatase-like domain profile. | 8 | 98 | 29.773 |
| 6 | g9553.t1 | SUPERFAMILY | SSF54975 | Acylphosphatase/BLUF domain-like | 6 | 97 | 3.49E-26 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003998 | acylphosphatase activity | MF |
KEGG
Orthology
- This transcript has been annotated with K01512 (acylphosphatase)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
