General information for g9709.t2
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Putative ATP synthase subunit f, mitochondrial.
Parent gene
- The parent gene g9709 is located on chr_1: 4763068..4763595 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g9709 | g9709.t2 | isoform | g9709.t2 | 4755319 | 4763595 |
| chr_1 | g9709 | g9709.t2 | exon | g9709.t2.exon1 | 4755319 | 4755340 |
| chr_1 | g9709 | g9709.t2 | exon | g9709.t2.exon2 | 4762917 | 4763096 |
| chr_1 | g9709 | g9709.t2 | cds | g9709.t2.CDS1 | 4763068 | 4763096 |
| chr_1 | g9709 | g9709.t2 | exon | g9709.t2.exon3 | 4763164 | 4763379 |
| chr_1 | g9709 | g9709.t2 | cds | g9709.t2.CDS2 | 4763164 | 4763379 |
| chr_1 | g9709 | g9709.t2 | exon | g9709.t2.exon4 | 4763517 | 4763595 |
| chr_1 | g9709 | g9709.t2 | cds | g9709.t2.CDS3 | 4763517 | 4763595 |
| chr_1 | g9709 | g9709.t2 | TSS | g9709.t2 | 4763652 | 4763652 |
| chr_1 | g9709 | g9709.t2 | TTS | g9709.t2 | NA | NA |
Sequences
>g9709.t2 Gene=g9709 Length=497
ATGGGATTTGGTGATTATCCAGCAGAATACAATCCAAAGATTCATGGCGTCTATGATCCA
GCACGCTATTATGGCAAACCTGATACTCCATTGAGTCAGGTTAAATTAAACGAGTTAGGT
GCATGGATCGGAAGAAGAAATAAGACACCAAGTGCTATTGCAGGAGCTTGCTCAAGAGCT
TGGTGGAGATGGCAACATAAGTATATGCAGCCACGCCGCAGTACAATGGCTCCTTATTTC
CAATTGATTGTTGGCTCAATGATCTTCTTTTATGCTATTAATTATGGCAAAATCACTGCA
CACAGAAATTACAAATACCATTAAGCTAATTTTGACGTTCCAACATCAATCTGAAGTAGC
TTTGAGCTCATGCAAGAACATCCAGCAAATTAGAATCCTTCGATCCGCTTATTGTCAAAA
AATTCAAGATGTGAAAATTTAGAGGATAAATAAAAATTCATGGAAAATTCAATTTAAAAG
AATTTAATATTCTTACC
>g9709.t2 Gene=g9709 Length=107
MGFGDYPAEYNPKIHGVYDPARYYGKPDTPLSQVKLNELGAWIGRRNKTPSAIAGACSRA
WWRWQHKYMQPRRSTMAPYFQLIVGSMIFFYAINYGKITAHRNYKYH
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g9709.t2 | PANTHER | PTHR13080:SF5 | ATP SYNTHASE SUBUNIT F, MITOCHONDRIAL-RELATED | 1 | 107 | 5.6E-39 |
| 3 | g9709.t2 | PANTHER | PTHR13080 | ATP SYNTHASE F CHAIN, MITOCHONDRIAL-RELATED | 1 | 107 | 5.6E-39 |
| 1 | g9709.t2 | Pfam | PF10206 | Mitochondrial F1F0-ATP synthase, subunit f | 3 | 103 | 2.0E-51 |
| 6 | g9709.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 75 | - |
| 7 | g9709.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 76 | 95 | - |
| 5 | g9709.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 96 | 107 | - |
| 4 | g9709.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 77 | 96 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K02130 (F-type H+-transporting ATPase subunit f)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
